PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 284aa    MW: 32574.8 Da    PI: 7.5378
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25119.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.82.4e-5491341128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lppGfrFhPtdeel+v+yLk++++++++++ ++i+evdiyk++Pw+Lp k++ +e+ewyfFs+rd+ky++g r+nrat sgyWkatg+dk+++s +++ v
  PK25119.1   9 LPPGFRFHPTDEELIVYYLKNQATSRPCPV-SIIPEVDIYKFDPWQLPDKAEFGENEWYFFSPRDRKYPNGVRPNRATISGYWKATGTDKAIYS-GSKYV 106
                79****************************.89***************99999*****************************************.999** PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                g+kk Lvfykg+ pkg ktdW+mheyrl
  PK25119.1 107 GVKKALVFYKGKPPKGIKTDWIMHEYRL 134
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.18E-665161IPR003441NAC domain
PROSITE profilePS5100561.4939161IPR003441NAC domain
PfamPF023654.1E-2710134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEAKTGSGLP PGFRFHPTDE ELIVYYLKNQ ATSRPCPVSI IPEVDIYKFD PWQLPDKAEF  60
GENEWYFFSP RDRKYPNGVR PNRATISGYW KATGTDKAIY SGSKYVGVKK ALVFYKGKPP  120
KGIKTDWIMH EYRLTDSRRQ ITKHVGSMRL DDWVLCRIYK KRNVNKALDP KVEDLSPHID  180
VTTVANEAIN EDNETLKFPR TYSLAQLLDL DYLGPISQLL NDNPFNSAHD FLLNNTLTNP  240
GTGFVQKFEF GEEIPYQNAD SGRFQVAQTS TPFTPGYDMY CSDR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-70516313167NO APICAL MERISTEM PROTEIN
1ut4_B3e-70516313167NO APICAL MERISTEM PROTEIN
1ut7_A3e-70516313167NO APICAL MERISTEM PROTEIN
1ut7_B3e-70516313167NO APICAL MERISTEM PROTEIN
3swm_A3e-70516316170NAC domain-containing protein 19
3swm_B3e-70516316170NAC domain-containing protein 19
3swm_C3e-70516316170NAC domain-containing protein 19
3swm_D3e-70516316170NAC domain-containing protein 19
3swp_A3e-70516316170NAC domain-containing protein 19
3swp_B3e-70516316170NAC domain-containing protein 19
3swp_C3e-70516316170NAC domain-containing protein 19
3swp_D3e-70516316170NAC domain-containing protein 19
4dul_A3e-70516313167NAC domain-containing protein 19
4dul_B3e-70516313167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108694.11e-161NAC domain-containing protein 29
SwissprotO492551e-118NAC29_ARATH; NAC transcription factor 29
TrEMBLW9S8C61e-161W9S8C6_9R
STRINGVIT_01s0026g02710.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-119NAC-like, activated by AP3/PI